Discords
discord server logo

BDSM Obedience Academy

Server Description
Emojis
spankbuttblugbuttspankshyballgagsmilecuteheartgoodnightgoodboygoodgungiggleemoji_173emoji_174emoji_175harnesscatsobcumroseemoji_181chillscissorshuhdad4e08b1b084eeea64c3397429f5af2metalcagepinkcagespankmemamabondageheartgoodgirlgoodpetgoodboybd_gaggedgag_droolring_gagl_gagtoy_blindfoldyou_bad_badbdsmCoinskneelBeltBreakthesubsbreedmedaddychockmemommydaddydomdirtyslutfuckmemastergoodslutmyfetishpinkpawpleasemasterslavespankmemastertiedtrueyesmaamyessirScaredcryShockedmaskBlood_coladastsmall507x507pad600x600f8f8f811stsmall507x507pad600x600f8f8f8stsmall507x507pad600x600f8f8f8feelsgofroggunsgoodpeperudesadBDSM_OA_hiawwumbreonheartlovesipcumsinsideyouasafriend_land_kiz10935366764433449363284gchemoji14no5140_Furry_Orgasm9192huh9369satisfiedcheemsAL_aCatImSILLYAL_bPepeCuteSitCA100RJI_cathiCatPatscatPeekFADcuteemoji_37feelsshockedfroggoodLD_BexGasmLD_Heart_HandLD_hugLD_Cute_SmileL_TsumiLewdLD_CutemeonglaughingnapnekosleeppepeokyellowcuteflushedyellowgagfootBDSM_OA_ughcatSECT_xx_gagtransparent_emoji_128798df0d06a6211f0b9be07d9c662a09eBDSM_OA_BanHammerBDSM_OA_BanHammer2BDSM_OA_pizzaPizzaemoji_130emoji_13115161913182827294605pepegenius9976ridingcrop14660smirkgentle2677rainbowheart21459gemheartamethyst26305peperudolph76249heart73086gothheartwithrose66952holoheartblue84253pinkdiamondheart46700bruisedass33686baddie66862studmuffin95467pepeyessir80972fake3BDSM_OA_CollarBDSM_OA_HorseCock1116catoninetails37544nsfwdominanceManKneeling2WomanKneeling3WomanKneeling2WomanKneelingPersonKneelingManKneelingemoji_160emoji_161catie
Animated Emojis
riding2_ffspankpaddlespankingslapslapasianspankingspankingassghostheartKiss_my_Feetblindfold1face_fuck_blindfoldgif_feetcatpawmeowslappingcatangrydancingdisappearfrogkingfrognohihugmagicpepehugepridefogkangel2_ghost3704_NippleTease8724shycute25784waitingpeachcatBaby_KissCat_Besito2Cat_hugcnc_bunpatcnc_celebrateDP_pepebedphonehappykittyLD_Devil_heheLD_SadSongLizzymyy_SeductiveBlinkPat_kannathurstonscreuhhhhYoure_cute4zOR_yePhoolSECT_happySpankthighskittyBoobsBooba_fuckDemon_BoobaPegBoobasBDSM_OA_Banned13647pepolaugh
Stickers
good boyfetch the stickeat dogbondagegaggednakedandnmasturbatingim leavingisawwhatudeletedNoMemeThatsMyOpinionHowDoIRespondToThatH-h-hibeyourselfuncomfyLimitNotIgnoringSpellingMistaleattentionpleaseTopMepsyconfusedpantiesdroppedI'll cumSay shitLoadingBullshitPullPretty HeadCuteMasturbateSlapHittingPingShuckleTake off your clothes Fuck you Love yourself I see you STOPsamoyedsamoyed hiyaHEHEPikachu_EvilExcuse me?Take itSeriously?Good KnightPatVengeance
Social Media
KinklinkSu97561

Similar Servers

Daily BDSM Kink Tasks's icon

Daily BDSM Kink Tasks

1,986 Members

High Activity

A kinky Discord space for spanking lovers, from playful pats to harsh discipline. Find Doms, subs, rituals, and roleplay in a BDSM-friendly, consent-based community. https://discord.gg/avBzPbCdFD

The Orgasm Control Teasing Domain's icon

The Orgasm Control Teasing Domain

436 Members

Moderate Activity

A wickedly fun 18+ server built for edging, denial, teasing, and orgasm control. 💋 Obey your Dom(me), beg for release, or be denied forever. Your body is ours now. 🔐💦

Social Exposure's icon

Social Exposure

607 Members

High Activity

Bdsm roleplay Voyeur exposure exhibitionist humiliation strip games sub dom switch domme master slave etc...

Discords.com is not endorsed or affiliated in any way with Discord Inc.